PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0067s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 350aa    MW: 38763.7 Da    PI: 6.126
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0067s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-092753111955
                             HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                              +k +yps++++  LA+++gL+++q+ +WF N+R ++
  SapurV1A.0067s0070.1.p 275 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 311
                             45679*****************************885 PP

2ELK37.84e-13231252122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELK qLlr YsgyLgsLkqEF+
  SapurV1A.0067s0070.1.p 231 ELKGQLLRRYSGYLGSLKQEFM 252
                             9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-1895139IPR005540KNOX1
PfamPF037903.4E-2097135IPR005540KNOX1
SMARTSM012561.2E-24144195IPR005541KNOX2
PfamPF037911.6E-20147194IPR005541KNOX2
PfamPF037891.7E-10231252IPR005539ELK domain
SMARTSM011888.6E-8231252IPR005539ELK domain
PROSITE profilePS5121310.912231251IPR005539ELK domain
PROSITE profilePS5007113.086251314IPR001356Homeobox domain
SuperFamilySSF466891.8E-19253328IPR009057Homeodomain-like
SMARTSM003891.2E-12253318IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.4E-28256316IPR009057Homeodomain-like
CDDcd000861.02E-12263315No hitNo description
PfamPF059206.2E-17271310IPR008422Homeobox KN domain
PROSITE patternPS000270289312IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEGGGGDGGS STTSCMMAFG DNSNGLCPMM MPLMSSSSNT LFLPLPPPNN QGQNRIHSNA  60
SGSSSLILDD HHHNNTVTAT GCYFMDNNDG SSSSSSVKAK IMAHPHYHRL LGAYANCQKV  120
GAPPEVVARL EDACASAASM APANTGCIGE DPSLDQFMEA YCEMLTKYEQ ELSKPMKEAM  180
LFLQRVECQF KALTLSSPIS ACGDGNDRNV SSEEEVDVNS NFIDPQAEDQ ELKGQLLRRY  240
SGYLGSLKQE FMKKRKKGKL PKEARQQLLE WWSRHYKWPY PSESQKLALA ESTGLDQKQI  300
NNWFINQRKR HWKPSEDMQF VVMDAGHPHY YMDNVLGNPF PMDISPTLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1246255LKQEFMKKRK
2252256KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7554130.0AY755413.1 Populus alba x Populus tremula homeodomain protein ARBORKNOX1 (ARBORKNOX1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002564.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-155HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLQ5XLC90.0Q5XLC9_POPCN; Homeodomain protein ARBORKNOX1
STRINGVIT_10s0116g00190.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-136KNOX/ELK homeobox transcription factor